Report for Sequence Feature Glyma16g03980
Feature Type: gene_model
Chromosome: Gm16
Start: 3341727
stop: 3346497
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma16g03980
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G03690 AT
Annotation by Michelle Graham. TAIR10: Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein | chr3:911494-913643 REVERSE LENGTH=378
SoyBase E_val: 1.00E-171 ISS
GO:0009567 GO-bp
Annotation by Michelle Graham. GO Biological Process: double fertilization forming a zygote and endosperm
SoyBase N/A ISS
GO:0016051 GO-bp
Annotation by Michelle Graham. GO Biological Process: carbohydrate biosynthetic process
SoyBase N/A ISS
GO:0048868 GO-bp
Annotation by Michelle Graham. GO Biological Process: pollen tube development
SoyBase N/A ISS
GO:0005794 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0008375 GO-mf
Annotation by Michelle Graham. GO Molecular Function: acetylglucosaminyltransferase activity
SoyBase N/A ISS
GO:0016757 GO-mf
Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups
SoyBase N/A ISS
KOG0799
KOG
Branching enzyme
JGI ISS
PTHR19297 Panther
GLYCOSYLTRANSFERASE 14 FAMILY MEMBER
JGI ISS
PTHR19297:SF2 Panther
GALACTOSYLTRANSFERASE-RELATED
JGI ISS
PF02485 PFAM
Core-2/I-Branching enzyme
JGI ISS
UniRef100_G7L1K4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Xylosyltransferase n=1 Tax=Medicago truncatula RepID=G7L1K4_MEDTR
SoyBase E_val: 0 ISS
UniRef100_I1MKV8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MKV8_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma16g03980
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma16g03980
Paralog Evidence Comments
Glyma19g29570 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma16g03980 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.16g035500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma16g03980
Coding sequences of Glyma16g03980
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma16g03980.1 sequence type=CDS gene model=Glyma16g03980 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGGCTCAAAATCTTCATGGCCTCCTTCTTGGTGACCTCAATCTTGTTCTTTCTCCTCTTCATCCCCACAAGATTGACCATGCAATTCTCCACCCTGAGGCCACCTGTGAACTACTTCAGTGTACCCCCCAATAGCAGCAGGGCCTATCCAGTTAGTTTTGCATACCTAATCTCTGCTTCAAAAGGAGATGTTGTGAAGCTCAAGAGGCTGATGAGGGTGCTGTATCATCCAGGGAACTACTATCTGATCCATGTGGATTATGGTGCTCCACAGGCTGAACATAAGGCTGTGGCAGAATTTGTAGCTAGTGATCCTGTTTTTGGTCAAGTTGGGAATGTTTGGGTTGTGGGGAAGCCTAATTTGGTCACATATAGAGGACCAACCATGCTTGCTACCACTCTCCATGCTATGGCTATGCTTCTCAGGACTTGCCAATGGGATTGGTTTATTAATCTTAGTGCTTCTGATTATCCCTTGGTTACACAAGATGATCTAACCCAGGCGTTTTCTGGGTTGCCAAGGAGTACCAATTTCATACAGCATAGCAGTCAATTGGGTTGGAAATTCAATAAGAGAGGGAAGCCAATAATCATAGATCCGGGGCTTTATAGCCTTAATAAATCAGAAATTTGGTGGGTTATTAAGCAAAGGAGTCTTCCAACATCTTTTAAGCTCTACACAGGTTCAGCTTGGACAATACTATCAAGATCTTTTGCAGAATATTGCATAGTGGGGTGGGAAAATTTGCCAAGGACCCTCCTCCTCTACTACACCAACTTTGTGTCATCCCCAGAAGGATATTTCCAAACAGTTATATGCAACTCTGAAGACTACAAGAACACAACTGTTAACCATGATCTTCACTACATTACTTGGGACAACCCTCCAAAACAACACCCTAGGTCTCTAGGGCTTAAGGATTATAGGAGAATGGTTCTTACTAGCCGCCCGTTTGCCAGAAAATTCAAGAGAAATGATCCAGTTCTTGATAAAATTGATAGAGAACTTCTGAAGAGGTATCATGGGAAATTTTCCTATGGAGGATGGTGCTCTCAGGGTGGAAAACACAAAGCATGCTCAGGTTTGCGAACTGAGAATTATGGTGTGCTTAAGCCTGGTCCATCCTCAAGAAGACTGAAAAATCTGCTAACAAAACTTCTCTCTGATAAATTTTTTCGCAAACAACAGTGCAGGTAA
Predicted protein sequences of Glyma16g03980
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma16g03980.1 sequence type=predicted peptide gene model=Glyma16g03980 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGLKIFMASFLVTSILFFLLFIPTRLTMQFSTLRPPVNYFSVPPNSSRAYPVSFAYLISASKGDVVKLKRLMRVLYHPGNYYLIHVDYGAPQAEHKAVAEFVASDPVFGQVGNVWVVGKPNLVTYRGPTMLATTLHAMAMLLRTCQWDWFINLSASDYPLVTQDDLTQAFSGLPRSTNFIQHSSQLGWKFNKRGKPIIIDPGLYSLNKSEIWWVIKQRSLPTSFKLYTGSAWTILSRSFAEYCIVGWENLPRTLLLYYTNFVSSPEGYFQTVICNSEDYKNTTVNHDLHYITWDNPPKQHPRSLGLKDYRRMVLTSRPFARKFKRNDPVLDKIDRELLKRYHGKFSYGGWCSQGGKHKACSGLRTENYGVLKPGPSSRRLKNLLTKLLSDKFFRKQQCR*