Glyma16g03980 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g03980

Feature Type:	gene_model
Chromosome:	Gm16
Start:	3341727
stop:	3346497
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g03980

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G03690	AT	Annotation by Michelle Graham. TAIR10: Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein \| chr3:911494-913643 REVERSE LENGTH=378	SoyBase	E_val: 1.00E-171	ISS
GO:0009567	GO-bp	Annotation by Michelle Graham. GO Biological Process: double fertilization forming a zygote and endosperm	SoyBase	N/A	ISS
GO:0016051	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate biosynthetic process	SoyBase	N/A	ISS
GO:0048868	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen tube development	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0008375	GO-mf	Annotation by Michelle Graham. GO Molecular Function: acetylglucosaminyltransferase activity	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
KOG0799	KOG	Branching enzyme	JGI		ISS
PTHR19297	Panther	GLYCOSYLTRANSFERASE 14 FAMILY MEMBER	JGI		ISS
PTHR19297:SF2	Panther	GALACTOSYLTRANSFERASE-RELATED	JGI		ISS
PF02485	PFAM	Core-2/I-Branching enzyme	JGI		ISS
UniRef100_G7L1K4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Xylosyltransferase n=1 Tax=Medicago truncatula RepID=G7L1K4_MEDTR	SoyBase	E_val: 0	ISS
UniRef100_I1MKV8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MKV8_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma16g03980

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g03980

Paralog	Evidence	Comments
Glyma19g29570	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g03980 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g035500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g03980

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g03980

Limit To All Plant Sequences

>Glyma16g03980.1   sequence type=CDS   gene model=Glyma16g03980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGCTCAAAATCTTCATGGCCTCCTTCTTGGTGACCTCAATCTTGTTCTTTCTCCTCTTCATCCCCACAAGATTGACCATGCAATTCTCCACCCTGAGGCCACCTGTGAACTACTTCAGTGTACCCCCCAATAGCAGCAGGGCCTATCCAGTTAGTTTTGCATACCTAATCTCTGCTTCAAAAGGAGATGTTGTGAAGCTCAAGAGGCTGATGAGGGTGCTGTATCATCCAGGGAACTACTATCTGATCCATGTGGATTATGGTGCTCCACAGGCTGAACATAAGGCTGTGGCAGAATTTGTAGCTAGTGATCCTGTTTTTGGTCAAGTTGGGAATGTTTGGGTTGTGGGGAAGCCTAATTTGGTCACATATAGAGGACCAACCATGCTTGCTACCACTCTCCATGCTATGGCTATGCTTCTCAGGACTTGCCAATGGGATTGGTTTATTAATCTTAGTGCTTCTGATTATCCCTTGGTTACACAAGATGATCTAACCCAGGCGTTTTCTGGGTTGCCAAGGAGTACCAATTTCATACAGCATAGCAGTCAATTGGGTTGGAAATTCAATAAGAGAGGGAAGCCAATAATCATAGATCCGGGGCTTTATAGCCTTAATAAATCAGAAATTTGGTGGGTTATTAAGCAAAGGAGTCTTCCAACATCTTTTAAGCTCTACACAGGTTCAGCTTGGACAATACTATCAAGATCTTTTGCAGAATATTGCATAGTGGGGTGGGAAAATTTGCCAAGGACCCTCCTCCTCTACTACACCAACTTTGTGTCATCCCCAGAAGGATATTTCCAAACAGTTATATGCAACTCTGAAGACTACAAGAACACAACTGTTAACCATGATCTTCACTACATTACTTGGGACAACCCTCCAAAACAACACCCTAGGTCTCTAGGGCTTAAGGATTATAGGAGAATGGTTCTTACTAGCCGCCCGTTTGCCAGAAAATTCAAGAGAAATGATCCAGTTCTTGATAAAATTGATAGAGAACTTCTGAAGAGGTATCATGGGAAATTTTCCTATGGAGGATGGTGCTCTCAGGGTGGAAAACACAAAGCATGCTCAGGTTTGCGAACTGAGAATTATGGTGTGCTTAAGCCTGGTCCATCCTCAAGAAGACTGAAAAATCTGCTAACAAAACTTCTCTCTGATAAATTTTTTCGCAAACAACAGTGCAGGTAA

Predicted protein sequences of Glyma16g03980

Limit To All Plant Sequences

>Glyma16g03980.1   sequence type=predicted peptide   gene model=Glyma16g03980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLKIFMASFLVTSILFFLLFIPTRLTMQFSTLRPPVNYFSVPPNSSRAYPVSFAYLISASKGDVVKLKRLMRVLYHPGNYYLIHVDYGAPQAEHKAVAEFVASDPVFGQVGNVWVVGKPNLVTYRGPTMLATTLHAMAMLLRTCQWDWFINLSASDYPLVTQDDLTQAFSGLPRSTNFIQHSSQLGWKFNKRGKPIIIDPGLYSLNKSEIWWVIKQRSLPTSFKLYTGSAWTILSRSFAEYCIVGWENLPRTLLLYYTNFVSSPEGYFQTVICNSEDYKNTTVNHDLHYITWDNPPKQHPRSLGLKDYRRMVLTSRPFARKFKRNDPVLDKIDRELLKRYHGKFSYGGWCSQGGKHKACSGLRTENYGVLKPGPSSRRLKNLLTKLLSDKFFRKQQCR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain